Ph: 145279223
 Search   for    
 Display   Show    Hide:     
  Range: from   to  Features:                  
1:  NM_009917Reports  Mus musculus chem...[gi:162287125] Links
Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
            Sciurognathi; Muroidea; Muridae; Murinae; Mus.
REFERENCE   1  (bases 1 to 2926)
  AUTHORS   Komatsu,K., Miyazaki,D., Morohoshi,K., Kuo,C.H.,
            Kakimaru-Hasegawa,A., Komatsu,N., Namba,S., Haino,M., Matsushima,K.
            and Inoue,Y.
  TITLE     Pathogenesis of herpetic stromal keratitis in CCR5- and/or
            CXCR3-deficient mice
  JOURNAL   Curr. Eye Res. 33 (9), 736-749 (2008)
   PUBMED   18798077
REFERENCE   2  (bases 1 to 2926)
  AUTHORS   Kohlmeier,J.E., Miller,S.C., Smith,J., Lu,B., Gerard,C.,
            Cookenham,T., Roberts,A.D. and Woodland,D.L.
  TITLE     The chemokine receptor CCR5 plays a key role in the early memory
            CD8+ T cell response to respiratory virus infections
  JOURNAL   Immunity 29 (1), 101-113 (2008)
   PUBMED   18617426
  REMARK    GeneRIF: we demonstrate a crucial role for C-C chemokine receptor 5
            (CCR5) in the accelerated recruitment of memory CD8(+) T cells to
            the lung airways during virus challenge
REFERENCE   3  (bases 1 to 2926)
  AUTHORS   van Deventer,H.W., Wu,Q.P., Bergstralh,D.T., Davis,B.K.,
            O'Connor,B.P., Ting,J.P. and Serody,J.S.
  TITLE     C-C chemokine receptor 5 on pulmonary fibrocytes facilitates
            migration and promotes metastasis via matrix metalloproteinase 9
  JOURNAL   Am. J. Pathol. 173 (1), 253-264 (2008)
   PUBMED   18535183185510721877694992613479184207913969986628908631787
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BY198155.1, BC103574.1, AK155628.1 and BG091923.1.
            On Dec 11, 2007 this sequence version replaced gi:145279223.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the
            Entrez Gene record to access additional publications.
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-61                BY198155.1         2-62
            62-1388             BC103574.1         1-1327
            1389-2549           AK155628.1         1363-2523
            2550-2924           AK155628.1         2525-2899
            2925-2926           BG091923.1         3-4                 c
FEATURES             Location/Qualifiers
     source          1..2926
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="9"
                     /map="9 72.0 cM"
     gene            1..2926
                     /gene="Ccr5"
                     /gene_synonym="AM4-7"
                     /gene_synonym="CD195"
                     /gene_synonym="Cmkbr5"
                     /note="chemokine (C-C motif) receptor 5"
                     /db_xref="GeneID:12774"
                     /db_xref="MGI:107182"
     exon            1..93
                     /gene="Ccr5"
                     /gene_synonym="AM4-7"
                     /gene_synonym="CD195"
                     /gene_synonym="Cmkbr5"
                     /inference="alignment:Splign"
                     /number=1
     STS             58..1388
                     /gene="Ccr5"
                     /gene_synonym="AM4-7"
                     /gene_synonym="CD195"
                     /gene_synonym="Cmkbr5"
                     /db_xref="UniSTS:489121"
     exon            94..2926
                     /gene="Ccr5"
                     /gene_synonym="AM4-7"
                     /gene_synonym="CD195"
                     /gene_synonym="Cmkbr5"
                     /inference="alignment:Splign"
                     /number=2
     STS             101..346
                     /gene="Ccr5"
                     /gene_synonym="AM4-7"
                     /gene_synonym="CD195"
                     /gene_synonym="Cmkbr5"
                     /standard_name="PMC122923P1"
                     /db_xref="UniSTS:270414"
     CDS             105..1169
                     /gene="Ccr5"
                     /gene_synonym="AM4-7"
                     /gene_synonym="CD195"
                     /gene_synonym="Cmkbr5"
                     /note="chemokine (C-C) receptor 5"
                     /codon_start=1
                     /product="chemokine (C-C motif) receptor 5"
                     /protein_id="NP_034047.2CCDS40821.1"
                     /db_xref="GeneID:12774"
                     /db_xref="MGI:107182"
                     /translation="MDFQGSVPTYSYDIDYGMSAPCQKINVKQIAAQLLPPLYSLVFI
                     FGFVGNMMVFLILISCKKLKSVTDIYLLNLAISDLLFLLTLPFWAHYAANEWVFGNIM
                     CKVFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKVRTVNFGVITSVVTWAVAVF
                     ASLPEIIFTRSQKEGFHYTCSPHFPHTQYHFWKSFQTLKMVILSLILPLLVMVICYSG
                     ILHTLFRCRNEKKRHRAVRLIFAIMIVYFLFWTPYNIVLLLTTFQEFFGLNNCSSSNR
                     LDQAMQATETLGMTHCCLNPVIYAFVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNP
                     DRASSVYTRSTGEHEVSTGL"
     STS             317..396
                     /gene="Ccr5"
                     /gene_synonym="AM4-7"
                     /gene_synonym="CD195"
                     /gene_synonym="Cmkbr5"
                     /standard_name="PMC228408P2"
                     /db_xref="UniSTS:272155"
     STS             612..1067
                     /gene="Ccr5"
                     /gene_synonym="AM4-7"
                     /gene_synonym="CD195"
                     /gene_synonym="Cmkbr5"
                     /standard_name="PMC24402P2"
                     /db_xref="UniSTS:272255"
     STS             943..1017
                     /gene="Ccr5"
                     /gene_synonym="AM4-7"
                     /gene_synonym="CD195"
                     /gene_synonym="Cmkbr5"
                     /standard_name="PMC151896P1"
                     /db_xref="UniSTS:271190"
     STS             982..1138
                     /gene="Ccr5"
                     /gene_synonym="AM4-7"
                     /gene_synonym="CD195"
                     /gene_synonym="Cmkbr5"
                     /standard_name="Cmkbr5"
                     /db_xref="UniSTS:141359"
     STS             1255..1427
                     /gene="Ccr5"
                     /gene_synonym="AM4-7"
                     /gene_synonym="CD195"
                     /gene_synonym="Cmkbr5"
                     /db_xref="UniSTS:224352"
     STS             1443..1572
                     /gene="Ccr5"
                     /gene_synonym="AM4-7"
                     /gene_synonym="CD195"
                     /gene_synonym="Cmkbr5"
                     /standard_name="D83648"
                     /db_xref="UniSTS:159945"
     polyA_signal    2907..2912
                     /gene="Ccr5"
                     /gene_synonym="AM4-7"
                     /gene_synonym="CD195"
                     /gene_synonym="Cmkbr5"
                     /note="putative"
ORIGIN      
        1 gtgtttctta ctttatactg tcttcatgtt agatttgtac agctctccta gccagaggag
       61 gtgagacatc cgttccccct acaagagact ctggctcttg caggatggat tttcaagggt
      121 cagttccgac ctatagctat gacatcgatt atggtatgtc agcaccctgc caaaaaatca
      181 atgtgaaaca aattgcggct cagctcctgc ccccactcta ctccctggta ttcatctttg
      241 gttttgtggg taacatgatg gtcttcctca tcttgataag ctgcaaaaag ctgaagagcg
      301 tgactgatat ctacctgctc aacctggcca tctctgacct gctcttcctg ctcacactac
      361 cattctgggc tcactatgct gcaaatgagt gggtctttgg gaacataatg tgtaaagtat
      421 tcacagggct ctatcacatt ggttattttg gtggaatctt cttcattatc ctcctgacaa
      481 ttgataggta cttggctatt gtccatgctg tgtttgcttt aaaagtcaga acggtcaact
      541 ttggggtgat aacaagtgta gtcacttggg cggtggctgt gtttgcctct ctcccagaaa
      601 taatctttac cagatctcag aaagaaggtt ttcattatac atgcagtcct cattttccac
      661 acactcagta tcatttctgg aagagtttcc aaacattaaa gatggtcatc ttgagcctga
      721 tcctgcctct acttgtcatg gtcatctgct actcaggaat tctccacacc ctgtttcgct
      781 gtaggaatga gaagaagagg cacagggctg tgaggctcat ctttgccatc atgattgtct
      841 actttctctt ctggactccc tacaacattg tcctcctcct gaccaccttc caggaattct
      901 ttggactgaa taactgcagt agttctaata gactagacca ggccatgcag gcaacagaga
      961 ctcttggaat gacacactgc tgcctaaacc ctgtcatcta tgcctttgtt ggagagaagt
     1021 tccggagtta tctctcagtg ttcttccgaa aacacatggt caaacgcttt tgcaaacggt
     1081 gttcaatttt ccagcaagac aatcctgatc gtgcaagctc agtctatacc cgatccacag
     1141 gagaacatga agtttctact ggtttatgac ctggttgact tttgtgtatc acgtagtttt
     1201 tctatgcagc ttgggagtag gaatggttct tttaaaaaaa gaaattagta tcatagaggg
     1261 cccaagatac atgcatcttt ttgatattta tttttagata gattgggtct tttaaaactg
     1321 aatggggagg ttggggtgga ggagcaggga gaacgagtct tttatcaggg ccgggaaata
     1381 tgcacaaaga gacttgaggc aggtgccatg acccatatgc aaagggacgg acacagggcc
     1441 gatgctgtgg cctagagatg acgtgtctca ccgctgggtt cctgaaaggc ggctgtaaat
     1501 atgcctgatt gccataaagt cgcttcttgc tgtctatgga tgtgcctgac tgccaacagg
     1561 gaagaaccac ttctgcctat aaaacgtaga gtcagcagaa cttggggtaa atcggagtta
     1621 gaggtgcata agaaccccta ggcttagtta ggttgaaata cccattgagg aaacagcaaa
     1681 tacaaaggaa gaataaagag tttagccggg aaggtagtct cattttacag ccggaatata
     1741 atgttatctc aggctagcat tttgttcctg ccttcagacc taaatcctac cacaccggga
     1801 ctgtgaaaca cctggattat gaatcatgag cctgaggtct aggaataata ataacgtttg
     1861 tgattttaga tgagggctgt ttccatagtt tgaagccaga actttatcat cttgagcaga
     1921 agctccaaga gatgaggaaa gagcaccaat ttttctctaa tttacttagc agtcatcatc
     1981 tctggaagat tcattttaga aacaagttgt tgtgcccctc agaagccatg agagtataac
     2041 gactgctctc tgtgttccag gctgagtatg aggacttcag tcacactttc cagatggctt
     2101 ctccacacaa acaatgctaa gtttggccat ttcagaggtt taggattttt tgttgttttt
     2161 gcagttgata ttttgaattt tagagcagtt gagatcttcc tagtgaaggc tagaggagga
     2221 aagaaagggg ttagaatctc tcaggagatt aaagtttctg cctaacaaga ggtgttactg
     2281 gtttttctca agctccgatt gtgaaaccag aggcctggga ctgtcagcag gaagtgagca
     2341 tttgcttttt tcttccttgt gatccacatt cctcccccac tctgttgctc agactggcgt
     2401 caagctcacg atcctcctgc ttacatctca agttctgaga ttacaagtat atgtgaacat
     2461 atccagcggt tattttattc attagcatat agaaagttat acgttctttg aagataatga
     2521 gtcttataaa aagtgctttg taaaaaaaat tgcattttat actttcaatc aagtgtacat
     2581 ttagtgagta gtacgtaaaa ttatgagagt attttgtaag tagttgtttt ggagaacgcc
     2641 cccaataata cttgtttaaa tatagcgttc ttggattaag tgggtggtgg tgatgataat
     2701 atttccttga aagtattttt agccgttaac tttcttcctt aaacaatttt tcataataat
     2761 ttgttcttaa agatgttatg tccaagcatg cagtttcgga gcagtgttgc tttgaaagag
     2821 tgtaaatttt aaattgtgct tactctcaat caaaagagtt ttaacatatt tacgaattta
     2881 tttcagaagt caagaatctg gttgaaaata aagatatgca acttta
//
"
                     /db_xref="GI:31542356"
                     /db_xref="CCDS:
  REMARK    Erratum:[J Biol Chem 1996 Sep 20;271(38):23601]
REFERENCE   10 (bases 1 to 2926)
  AUTHORS   Boring,L., Gosling,J., Monteclaro,F.S., Lusis,A.J., Tsou,C.L. and
            Charo,I.F.
  TITLE     Molecular cloning and functional expression of murine JE (monocyte
            chemoattractant protein 1) and murine macrophage inflammatory
            protein 1alpha receptors: evidence for two closely linked C-C
            chemokine receptors on chromosome 9
  JOURNAL   J. Biol. Chem. 271 (13), 7551-7558 (1996)
   PUBMED   
REFERENCE   9  (bases 1 to 2926)
  AUTHORS   Meyer,A., Coyle,A.J., Proudfoot,A.E., Wells,T.N. and Power,C.A.
  TITLE     Cloning and characterization of a novel murine macrophage
            inflammatory protein-1 alpha receptor
  JOURNAL   J. Biol. Chem. 271 (24), 14445-14451 (1996)
   PUBMED   
REFERENCE   8  (bases 1 to 2926)
  AUTHORS   Nibbs,R.J., Wylie,S.M., Pragnell,I.B. and Graham,G.J.
  TITLE     Cloning and characterization of a novel murine beta chemokine
            receptor, D6. Comparison to three other related macrophage
            inflammatory protein-1alpha receptors, CCR-1, CCR-3, and CCR-5
  JOURNAL   J. Biol. Chem. 272 (19), 12495-12504 (1997)
   PUBMED   
REFERENCE   7  (bases 1 to 2926)
  AUTHORS   Bieniasz,P.D., Fridell,R.A., Aramori,I., Ferguson,S.S., Caron,M.G.
            and Cullen,B.R.
  TITLE     HIV-1-induced cell fusion is mediated by multiple regions within
            both the viral envelope and the CCR-5 co-receptor
  JOURNAL   EMBO J. 16 (10), 2599-2609 (1997)
   PUBMED   
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 2926)
  AUTHORS   Doranz,B.J., Lu,Z.H., Rucker,J., Zhang,T.Y., Sharron,M., Cen,Y.H.,
            Wang,Z.X., Guo,H.H., Du,J.G., Accavitti,M.A., Doms,R.W. and
            Peiper,S.C.
  TITLE     Two distinct CCR5 domains can mediate coreceptor usage by human
            immunodeficiency virus type 1
  JOURNAL   J. Virol. 71 (9), 6305-6314 (1997)
   PUBMED   
  REMARK    GeneRIF: The expression of vMIP II showed considerable prolongation
            of graft survival.
REFERENCE   5  (bases 1 to 2926)
  AUTHORS   Lu,P., Li,L., Wu,Y., Mukaida,N. and Zhang,X.
  TITLE     Essential contribution of CCL3 to alkali-induced corneal
            neovascularization by regulating vascular endothelial growth factor
            production by macrophages
  JOURNAL   Mol. Vis. 14, 1614-1622 (2008)
   PUBMED   
  REMARK    GeneRIF: a novel role for CCR5 in the migration of pulmonary
            fibrocytes and the promotion of metastasis.
REFERENCE   4  (bases 1 to 2926)
  AUTHORS   Pillai,R.G., Beutelspacher,S.C., Larkin,D.F. and George,A.J.
  TITLE     Expression of the chemokine antagonist vMIP II using a non-viral
            vector can prolong corneal allograft survival
  JOURNAL   Transplantation 85 (11), 1640-1647 (2008)
   PUBMED   
LOCUS       NM_009917               2926 bp    mRNA    linear   ROD 02-NOV-2008
DEFINITION  Mus musculus chemokine (C-C motif) receptor 5 (Ccr5), mRNA.
ACCESSION   NM_009917
VERSION     NM_009917.5  GI:162287125
KEYWORDS    .
SOURCE      Mus musculus (house mouse)
  ORGANISM  

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH

 

Last update: Wed, 05 Nov 2008 Rev. 145015


You are viewing a mobilized version of this site...
View original page here

How do you rate mobile version of this page?

Mobilized by Mowser Mowser